Glass fragrance essential
Top sales list glass fragrance essential
![Fragrance oil lamp glass fragrance effusion lamp catalytic Fragrance oil lamp glass fragrance effusion lamp catalytic](https://img.clasf.co.za/2024/09/16/Fragrance-Oil-Lamp-Glass-Fragrance-Effusion-Lamp-Catalytic-20240916150507.7735820015.jpg)
South Africa (All cities)
Buy Fragrance Oil Lamp Glass Fragrance Effusion Lamp Catalytic Wick Burner for R450.00
R 450
See product
![Iba indianbeautifulart glass akhand jyot om hindu religious Iba indianbeautifulart glass akhand jyot om hindu religious](https://img.clasf.co.za/2021/07/02/IBA-Indianbeautifulart-Glass-Akhand-Jyot-Om-Hindu-Religious-20210702051659.2784860015.jpg)
South Africa (All cities)
Buy IBA Indianbeautifulart Glass Akhand Jyot Om Hindu Religious Brass Oil Lamp Pooja Essential Diwali for R260.99
R 260
See product
![Usb aromatherapy oil heating indoor portable air freshener Usb aromatherapy oil heating indoor portable air freshener](https://img.clasf.co.za/2020/05/07/USB-Aromatherapy-Oil-Heating-Indoor-Portable-Air-Freshener-20200507050741.6031480015.jpg)
South Africa (All cities)
Buy USB Aromatherapy Oil Heating Indoor Portable Air Freshener Fragrance Essential Oils Diffuser (White) for R76.99
R 76
See product
![Cnc 1300x900 laser cutting and engraving machine for conquering the world of signage Cnc 1300x900 laser cutting and engraving machine for conquering the world of signage](/static/img/caticons/servicios.png)
Vryheid (KwaZulu Natal)
TruCUT-Series Cabinet Dual Head 130W CO2 Laser Cutter 1300×900mm Complete Set (NEW) SKU:LC-1390/D130 R187999 0726167408 http://am.co.za/laser/cabinet # The advent of science and technology along with many original ideas has made almost anything achievable. At this time, you can engrave intricately even on a very minute object, e.g. Plexiglax with exactness with the help of CNC CO2 Cabinet Laser Cutting Machine. Are you in the company gift making, shop-fitting or sign-making industry? Then most likely, you are familiar with of the vast range of utilities for these CNC CO2 Cabinet Laser Cutting and Engraving Machine. The TruCUT CO2 Cabinet Laser Cutting and Engraving Machine from Advanced Machinery can be seen as a step in the right direction in this field. As the name suggests, these machines help you to cut and engrave on Glass, Glass, Wood and an array of non-metallic surfaces with an precision of 0.01 millimeter. To know more about these products please visit our website: http://am.co.za/laser/cabinet # and browse through all its highlights and specifications. In case you have any question please leave us a message or Call at 0726167408 to answer your questions. We guarantee that our product will prove essential for your work and it is well worth every cent spent. Check some of the main functions of Our TruCUT CO2 Cabinet Laser Cutters. Some of the added perks you get with every purchase are - firstly, a longer period of warranty that covers 1 year electronic, 2 years mechanical and 5 years on structural. Secondly, complimentary maintenance and service plan, every 3 months. Lastly, you are given related software to run this machine that is compatible with all operating systems of Windows. To check more about the products, visit our page: http://am.co.za/laser/cabinet # You can get more information our products online. If you want this product do not hesitate to CALL at 0726167408 Now. Advanced Machinery is making industry machines at "made in China" prices locally here by working together with machine factories and building up assemble lines in Joburg. After all, you still get the super affordable price of equipments made in China and great service and the after-sales support you deserve. Please open our website: http://am.co.za/ # for CNC Routers, Paper Cutter, CNC Laser Cutter, CNC Plasma and more.
R 187.999
See product
![3kw signmaking cnc router, 220v electricity, tslot 1300x2500mm clamps table factory sale, 3kw signmaking cnc router, 220v electricity, tslot 1300x2500mm clamps table factory sale,](/static/img/caticons/servicios.png)
Boksburg (Gauteng)
EasyRoute 1300×2500 3kW CNC Sign-Making Router, 220V, Water Cooled Spindle, Clamping Table (New) SKU:R-1325C/30 for R129999 072 133 3669 http://am.co.za/router/advertising # T-Slot Clamping Table Made from structural aluminum alloy with a protected by PVC board layer, our most concluding T-Slot clamping table is the most effective working board and spoilboard fixer on your working surface. As no electricity is required it is easy for cutting and 3D surface engraving, also including 6 sets of clamping tools freeof charge. When you have any questions regarding this product, please check : http://am.co.za/router/advertising # and feel free to Call 072 133 3669 or our sales representatives. They will address your queries and assist you make an informed decision. Life-time Maintenance We are always able to maintain and fix our cnc routers. We stock all essential CNC Routing Machine spares for the lifetime of the machine ( normally up to 10 years ) to give you true peace of mind. 3 Axis CNC Routering Machine Elements & Performance This is the main part where the routing machine performs. It is the core and essential component with leading 3 Axis X, Y & Z. It has driving motor with 1.8 degree stepper motor, including maximum speed, pulse equivalent, resolution and working area. You can read through our large range of products on this webpage: http://am.co.za/router/advertising # We are believing that you will find the suitable products for your business. Have an inquiry, feel free to contact 072 133 3669 The perfect signage router coming out from our Advertising Router Machine Sets has greatly proved to be a signpost especially when it comes in sign making by cutting ABS plastic boards, Perspex Acrylic Glass, Komotex engraving effectively on SupaWood, every kinds of wood and Rowmark easily. All the plates are holding by the T-slot clamping table easily that are not much harder than copper plates which gets them machined easily. These machines require only 220V house-hold electricity which proves, that it is the fastest, reliable and the most finely signmaking machines in the industry. To learn more about our product, visit our webpage: http://am.co.za/router/advertising # You can get more our product online. If you want this product do not hesitate to CALL 072 133 3669 Today. Advanced Machinery is building machines at "made in China" prices locally here by working with machinery factories and setting up assemble-lines in Joburg. At last, you still get the very cheap price of machinery made in China plus great services and the after-sale support you deserve. Please get more info from our website: http://am.co.za/ # for CNC Routing Machine, CNC Paper Cutter, Laser Machine, CNC Plasma Cutter and more.
R 129.999
See product
![5.5kw signage cnc routing machine, 220v electricity, fast 2000x3000mm clamp table factory 5.5kw signage cnc routing machine, 220v electricity, fast 2000x3000mm clamp table factory](/static/img/caticons/servicios.png)
Newcastle (KwaZulu Natal)
EasyRoute 2000×3000 High-Torque 5.5kW CNC Wood Router, 380V, Water Cooled Spindle, Clamping Table Brand New SKU:R-2030K/55L > R182999 0739967892 http://am.co.za/router/advertising # 3 Axes CNC Routering Machine Elements & Performance This is the major component where the routing machine performs. It is the core and essential component with leading 3 Axes X, Y and Z. It has driving motor with 1.8 degree stepper motor, including maximum speed, pulse equivalent, resolution and working area. All our products are of industrial quality and best for industry use, so you do not need to worry about its quality, reliability and efficiency. For more information, please visit the information page: http://am.co.za/router/advertising # Or call on 0739967892 Quality Significance of CNC Signmaking Routering Machine The ultimate quality which brings the importance is the spindle. The Spindle disposes 50% of the electricity used by the nc router. The greatest amount of power that one can get from a 220V circuit breaker with a reasonable current is 5.5 kW at the same time standard tooling bits needs 24000 RPM. If you have questions about our products then, we would advice you to take a look at our website: http://am.co.za/router/advertising # where you can find all the highlights and details about our products. Please feel free to contact at 0739967892 Lifetime Maintenance We are always able to maintain and fix our machines. We stock all essential CNC Router spares for the lifetime of the machine ( normally up to 10 years ) to give you true peace of mind. With nationwide technical support and service, Our Quality build NC Signage Router, this is a benchmark in signage industry. The main purpose is to cut ABS plastic, Perspex Glass, Komotex, while engraving on Supawood and all kinds of wood. It is strongly built for achieving speed, accuracy and reliability for industrial and business users as it requires only 220V electricity and hold solid materials through its tightly holding clamping table that hold any solid materials. This machine is especially for those users who work with multiple tools. It provides maximum cutting area to work, fast speed and ideal cnc router system in all terms. If you have any queries regarding this product, please open : http://am.co.za/router/advertising # and feel free to CALL on 0739967892. I can address your queries and assist you make the right decision. Advanced Machinery is focussed on Computer Controlled Machines, automatic & half-automatic machines with high precision and high capacity. All our industry-usage machinery is for heavy usage, less downtime is ensured by quality build products, overstocked parts and always-available technicians. With the machine spare parts from all over the world, for example: machine main-body of China, servo motors of Japan, CNC control system of Taiwan, High Speed spindles of Italy, precision switch of German and Power Supplies of America, Advanced Machinery is capable of create world-class machinery for the African continent. Please visit our website http://am.co.za/ # for Laser Cutting & Engraving machines, Cut Vinyl, CNC Router and Plasma Cutting Machines and many more.
R 182.999
See product
![Data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wbdaaicagicaqicagidagidawyeawmdawcfbqqgcacjcaghc Data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wbdaaicagicaqicagidagidawyeawmdawcfbqqgcacjcaghc](/static/img/caticons/servicios.png)
Dannhauser (KwaZulu Natal)
EasyRoute 2000×3000 3kW CNC Sign-Making Router, 220V, Water Cooled Spindle, Clamping Table (NEW) SKU:R-2030C/30 → R154999 0724055174 http://am.co.za/router/advertising # Quality Significance of CNC Advertising Router The ultimate quality which brings the importance is the spindle. The Spindle disposes half of the electricity used by the router. The greatest amount of power that one can get from a 220V circuit breaker with a reasonable current is 3 kW at the same time standard tooling bits needs 24000 RPM. If you have queries about our products then, we recommend you to have a look at our website: http://am.co.za/router/advertising # where you will find all the highlights and details of our products. Please contact on 0724055174 Technical Support If you experience any problems, our expert technician support is available for your convenience. We also have a forum where our clients can post videos, explain or query any difficulties they may experienced or simply share tips and ideas. 3 Axes CNC Router Elements & Performance This is the main component where the routing machine performs. It is the core and essential component with leading 3 Axis X, Y & Z. It has driving motor with 1.8 degree stepper motor, including maximum speed, pulse equivalent, resolution and working envelope. Go to product page to get all details http://am.co.za/router/advertising # Or make contact with on 0724055174 when you have any questions on our product or its accessories. The top range improved machine comes with t-slot clamps table with holding capacity of any plate with greatest quality by cutting ABS, Perspex Glass, Komotex and 3D engraving on Supawood and all kinds of wood. Such quality is designed for high speed routering machines in the signage industry. It is highly powerful for large performance production worked in large format, as it requires 220V electricity . This ideal machine has carving facility for those customers who complete their tasks with more tools. The NC Signmaking Routering Machine can be worked quickly and efficiently as much time is saved due to the faster work of the machinery tools. When you have any queries regarding this product, please visit the information page: http://am.co.za/router/advertising # and feel free to Call on 0724055174. I will answer your queries and assist you make the right decision. Advanced Machinery is focussed on CNC Machines, automatic & semi automatic machines with high precision and high capacity. All our industry machines are for heavy use, minimized downtime is ensured by quality build products, overstocked parts and always available technicians. With the machine building parts from all over the world, for example: machine main-body of China, servo motors of Japan, CNC Module of Taiwan, High Speed Routing Spindle of Italy, Precision switch of German and Power Supply System of America, Advanced Machinery is capable of create world-class machinery for the African continent. Please open our company website http://am.co.za/ # for Laser Engraver, Vinyl Cutting Machine, CNC Router and Hypertherm Plasma and more.
R 155
See product
![3kw signage cnc router, 220v electricity, t slot 1300x2500mm clamp table factory sale, new 3kw signage cnc router, 220v electricity, t slot 1300x2500mm clamp table factory sale, new](/static/img/caticons/servicios.png)
Benoni (Gauteng)
EasyRoute 1300×2500 3kW CNC Sign-Making Router, 220V, Water Cooled Spindle, Clamping Table NEW SKU:R-1325C/30 -> R139999 0739967892 http://am.co.za/router/advertising # Lifetime Maintenance We are always able to maintain and fix our machines. We stock all essential CNC Router spares for the lifetime of the machine ( normally up to 10 years ) to give you true peace of mind. The perfect signage router coming out from our Advertising Routing Machine Sets has greatly proved to be a signpost especially when it comes in sign making by cutting ABS, Perspex, Komotex engraving effectively on SupaWood, every kinds of wood and Rowmark easily. All the materials are holding by the T-slot clamping table easily that are not much harder than aluminum plates which gets them machined easily. These cnc routers require only 220V household electricity which proves, that it is the fastest, reliable and the most finely sign-making machines in the industry. For further information, you can visit: http://am.co.za/router/advertising # Or call at 0739967892. Our client care representative are always happy to help you with all your queries and issues. The top range improved machine comes with clamping table with holding capacity of any material with greatest quality by cutting ABS plastic sheets, Perspex Glass, Komotex and engraving on Supawood and every kinds of wood. Such quality is designed for fast speed machines in the signage industry. It is highly powerful for large performance production worked in large format, as it requires 220V electricity . This ideal machine has engraving facility for those clients who complete their tasks with more tools. The NC Signmaking Router can be worked quickly and efficiently as much time is saved due to the faster work of the machinery tools. For further information, you can visit: http://am.co.za/router/advertising # Or call on 0739967892. Our customer care executives are always happy to help you with all your queries and concerns. Advanced Machinery is focussed on CNC Machinery, full automatic & semi automatic machinery with high precision and high capacity. All our industry-usage machines are for heavy usage, less downtime is ensured by quality-build products, overstocked parts and always available technicians. With the machine parts from all over the world, for example: machine structure of China, Servo Motor of Japan, CNC control system of Taiwan, High Speed spindles of Italy, Precision Switches of German and power system of America, Advanced Machinery is capable of create world-class machines for the African continent. Please get more info from our website http://am.co.za/ # for Laser Cutter, Cut Vinyl, CNC Wood Router and CNC Plasma and more.
R 140
See product
![Cnc router for sale, 3 axes cnc signmaking routing machine, 220v, fast clamp table, 6.5kw Cnc router for sale, 3 axes cnc signmaking routing machine, 220v, fast clamp table, 6.5kw](/static/img/caticons/servicios.png)
Beaufort-West (Western Cape)
EasyRoute 2000×3000 High-Torque 6.5kW CNC Wood Router, 380V, Water Cooled Spindle, Clamping Table NEW SKU:R-2030K/65L price R190999 0724055174 http://am.co.za/router/advertising # All our CNC Sign-making Routing Machine come with a strong technical support, warranty and service plan. We provide our customers with a free maintenance service every 3 months for the first year. So, if you run into any technical issue, our engineers are always there to help you out. The working in the Sign making has evolved a lot with the use of CNC Signage Business Router. Nowadays, there is need of fast speed, efficient and multifunction CNC Sign Making Routering Machine. The latest offering from our company is the EasyRoute three Axis CNC Sign-making Routing Machine that delivers plenty more than that. No matter you want to cut on different types of material like ABS, Perspex glass, Komotex sheet, etc., or you are looking to engrave MDF or are looking to perform 3D surface engraving, our machine can do it all. This CNC Router is an essential for everyone who want to take their Signmaking Business to greater achievements. Check out our web site to read details http://am.co.za/router/advertising # Or call at 0724055174 when you have any questions regarding our item or its add-ons. Advanced Machinery is focussed on Computerized Numerical Controlled Machines, completely automatic and semi automatic machinery with high precision and high capacity. All our commercial machines are for heavy use, minimal downtime is ensured by quality build products, over-stocked parts and always available technicians. With the machine parts from worldwide, for example: machine chassis of China, servo motors of Japan, CNC Modules of Taiwan, High-Speed Spindle of Italy, precision Switches of German and Power System of America, Advanced Machinery is capable of create world-class machines for the African continent. Please get more info from our company website http://am.co.za/ # for Laser Engraver, Cut Vinyl, CNC Marble Router and Plasma CNC Cutting Machine and more.
R 191
See product
![3kw signmaking cnc router, 220v electricity, 2000x3000mm clamps table for sale, new 3kw signmaking cnc router, 220v electricity, 2000x3000mm clamps table for sale, new](/static/img/caticons/servicios.png)
Tembisa (Gauteng)
EasyRoute 2000×3000 3kW CNC Wood Router Complete Set, 380V, Water Cooled Spindle, Clamping Table (NEW) SKU:R-2030K/30 > R169999 0739967892 http://am.co.za/router/advertising # The work scene in the Sign-making has changed a lot with the deploy of CNC Sign making Router. Nowadays, there is need of fast speed, electricity-saving and versatile CNC Sign making Routering Machine. The latest offering from Advanced Machinery is the EasyRoute three Axis CNC Signage Business Router that delivers much much more than that. Whether you need to cut on different types of plates like ABS plastic sheets, Perspex glass, Komotex form board, etc., or are looking to engrave MDF plates or are looking to perform 3D surface engraving, our machine can do those all. This CNC Router is an essential for everyone who want to take their Advertising to greater achievements. If you have queries about our products then, we would like you to have a look at our website: http://am.co.za/router/advertising # in there you will find all the features and details of our products. Please feel free to contact at 0739967892 Best Opportunities in the Advertising Industrial with our EasyRoute three Axis CNC Sign Making Router. All our CNC Sign-making Routing Machine come with a comprehensive technical support, quality warranty and service plan. We provide our customers with a Free service every 3 months for the first year. So, if you have any technical question, our engineers are always there to help you out. Call 0739967892 Now or Just open our website: http://am.co.za/router/advertising # Before purchase any other products, do not regret later for not choose what we offer. Advanced Machinery is building machines at "made in China" prices in South Africa by working with machinery factories and setting up assemble-lines in Johannesburg. After all, you still get the very affordable price of machine made in China and great services and the after-sale support you deserve. Please visit our website: http://am.co.za/ # for Marble Router, Vinyl Cutter, Laser Engraver, Plasma Cutter and many more.
R 169.999
See product
![Cnc router for sale, 3 axes cnc signmaking router, 220v, fast clamps table, 4.5kw Cnc router for sale, 3 axes cnc signmaking router, 220v, fast clamps table, 4.5kw](/static/img/caticons/servicios.png)
Ermelo (Mpumalanga)
EasyRoute 2000×3000 High-Torque 4.5kW CNC Wood Router Complete Set, 380V, Water Cooled Spindle, Clamping Table (NEW) SKU:R-2030K/45 -> R184999 0726167408 http://am.co.za/router/advertising # Lifetime Maintenance We are always able to maintain and repair our machines. We stock all essential CNC Routering Machine spares for the lifetime of the machine ( normally up to 10 years ) to give you true peace of mind. Technician Support If you experience any problems, our expert technician support is available for your convenience. We also have a forum where our users can post pictures, explain or query any difficulties they may experienced or simply share tips and ideas. To know more about these products please come to our site: http://am.co.za/router/advertising # and read through all its highlights and specifications. In case you have any query please leave us a message or CALL on 0726167408 to answer your questions. We assure you that our product will prove necessary for your work and it is well worth every cent spent. Spindle Drive: Variable Frequency Drive, Max Frequency 400Hz Bearing: Angular Contact Ball Bearing Available Z Axes Height: 300mm Spindle Speed: 0-24000 RPM Working Envelope: 2000×3000mm Data Port: USB 2.0 Port Supports USB Flash Drive up to 32 GB Collet: ER25 Maximum Speed: 12 Metres / Minute Power Consumption: %power%kW Resolution: 0.011681 millimeter If you could use additional information before deciding, don't hold off to call on 0726167408. I will answer your queries and put all your worries to rest. For more details please check our page at: http://am.co.za/router/advertising # and browse through it to find out more about our products and services. With nationwide technical support and service, Our Quality build NC Sign-Making Router, this is a benchmark in signage industry. The main purpose is to cut ABS, Perspex Acrylic Glass, Komotex, while engraving on MDF and every kinds of wood. It is strongly manufactured for achieving speed, accuracy and reliability for industrial & business users as it requires only 220V house-hold electricity and hold solid plates through its tightly holding clamping table that hold any solid materials. This cnc router is especially for those customers who work with multiple tools. It provides maximum working envelope to work, fast speed and ideal cnc router system in all terms. If you have questions about our products then, we would like you to take a look at our website: http://am.co.za/router/advertising # where you can find all the highlights and details of our products. Please contact on 0726167408 Advanced Machinery is focussed on Computerized Numerical Controlled Machinery, full automatic and semi-automatic machinery with high precision and high capacity. All our industry-used machines are for heavy usage, minimized downtime is ensured by quality-build products, over-stocked parts and always available technicians. With the machine building blocks from all over the world, for example: machine structure of China, Servo Motor of Japan, CNC System of Taiwan, Super High-Speed Spindles of Italy, Precision switch of German and power system of America, Advanced Machinery is capable of create world-class machinery for the African continent. Please get more info from our company website http://am.co.za/ # for CNC Laser Engraver, Paper Cutter, CNC Routers and Plasma Cutting and more.
R 184.999
See product
![7.5kw wood cnc router, 220v electricity, 2000x3000mm clamping table for sale, new 7.5kw wood cnc router, 220v electricity, 2000x3000mm clamping table for sale, new](/static/img/caticons/servicios.png)
Bisho (Eastern Cape)
EasyRoute 2000×3000 High-Torque 7.5kW CNC Wood Router Complete Set, 380V, Water Cooled Spindle, Clamping Table Brand New SKU:R-2030K/75 - R223999 0726167408 http://am.co.za/router/advertising # Lifetime Maintenance We are always able to maintain and fix our machinery. We stock all essential CNC Router spares for the lifetime of the machine ( normally up to 10 years ) to give you true peace of mind. The perfect signage router coming out from our Sign-Making Router Sets has greatly proved to be a signpost especially when it comes in sign making by cutting ABS plastic boards, Perspex Glass, Komotex engraving effectively on MDF, every kinds of wood and Rowmark easily. All the plates are holding by the t-slot clamping table easily that are not much harder than copper and aluminum plates which gets them machined easily. These cnc routers require only 220V house-hold electricity which proves, that it is the fastest, reliable and the most finely signmaking machines in the industry. You can read through our extensive selection of products on this website: http://am.co.za/router/advertising # We are believing that you will find the right kind of products for your business. Have an inquiry, do not hesitate to contact at 0726167408 Quality Significance of CNC Signage Router The ultimate quality which brings the importance is the spindle. The Spindle disposes 50% of the electricity used by the nc router. The greatest amount of power that one can get from a 220V electricity circuit breaker with a reasonable 12A current is 7.5 kW at the same time standard tooling bits needs 24000 RPM. You can read through our large range of products on our webpage: http://am.co.za/router/advertising # We are believing that you will find the right kind of products for your job. Have a question, do not hesitate to contact on 0726167408 Advanced Machinery is focussed on Computerized Numerical Controlled Machines, completely automatic & semi automatic machinery with high precision and high output capacity. All our commercial machines are for heavy usage, minimal downtime is ensured by quality build products, over stocked parts and always available technicians. With the machine building parts from four corners of the earth, for example: machine structure of China, Servo-Motors of Japan, CNC System of Taiwan, Super High-Speed Routing Spindle of Italy, Precision Switch of German and Power Supply System of America, Advanced Machinery is capable of create world-class machinery for the African continent. Please open our website http://am.co.za/ # for CNC Laser, CNC Paper Cutter, CNC Router and CNC Plasma Cut Machine and more.
R 223.999
See product
![Cnc router for sale, 3 axis cnc wood routering machine, 220v, t slot clamps table, 3kw Cnc router for sale, 3 axis cnc wood routering machine, 220v, t slot clamps table, 3kw](/static/img/caticons/servicios.png)
Johannesburg (Gauteng)
EasyRoute 2000×3000 3kW CNC Wood Router, 380V, Water Cooled Spindle, Clamping Table NEW SKU:R-2030K/30L → R164999 0726167408 http://am.co.za/router/advertising # With countrywide technical support and service, Our Quality build NC Sign-Making Router, this is a benchmark in signage industry. The main purpose is to cut ABS plastic sheets, Perspex Glass, Komotex, while 3D engraving on Supawood and every kinds of wood. It is strongly manufactured for achieving speed, accuracy and reliability for industrial & business users as it requires only 220V household electricity and hold solid boards through its tightly holding t-slot clamping table that hold any solid materials. This machine is especially for those users who work with multiple tools. It provides maximum working area to work, fast speed and ideal cnc machine system in all terms. To get more information about the products, visit our webpage: http://am.co.za/router/advertising # You can check our products from our website. If you have a thought do not hesitate to call on 0726167408 Today! Life-time Maintenance We are always able to maintain and repair our cnc router. We stock all essential CNC Router spares for the lifetime of the machine ( normally up to 10 years ) to give you true peace of mind. Power Consumption: %power%kW Resolution: 0.011681 millimeter Data Upload: USB 2.0 Port Supports USB Flash Drive up to 32 GB Working Area: 2000×3000mm Maximum Speed: 12 Metres / min Bearing: Angular Contact Ball Bearing Available Z Axis Distance: 300mm Collet: ER20 Spindle Speed: 0-24000 RPM Spindle Drive: VFD, Max Frequency 400Hz We can only place limited words in this ad. These are only some of the features of our products. If you want to get more info please check our detailed product page: http://am.co.za/router/advertising # . Please note that all our products come with a strong technical support and/or service maintenance plan. In case you have more questions feel free to contact on 0726167408. Advanced Machinery is making industry machines at "made in China" prices locally by working with machinery factories and building up assemble lines in Johannesburg. After all, you still get the super affordable price of equipments made in China plus great service and the after-sales support you deserve. Please visit our website: http://am.co.za/ # for Wood Router, Paper Cutter, Laser Engraver, Plasma Cutter and many more.
R 164.992
See product
![2000x4000mm 5kw cnc advertising router for sale, 220v electricity, easy clamps table 2000x4000mm 5kw cnc advertising router for sale, 220v electricity, easy clamps table](/static/img/caticons/servicios.png)
Alberton (Gauteng)
EasyRoute 2000×4000 5kW CNC Wood Router, 380V, Water Cooled Spindle, Clamping Table New SKU:R-2040K/50L for R220999 0739967892 http://am.co.za/router/advertising # The working in the Signage Business has evolved a lot with the use of CNC Sign making Routering Machine. Today, there is need of fast, efficient and versatile CNC Sign making Router. The latest offering from Advanced Machinery is the EasyRoute three Axes CNC Signage Router that provides much much more than that. Whether you want to cut out different types of material like ABS plastic sheets, Perspex glass, Komotex plate, etc., or you are looking to engrave MDF plates or are looking to produce 3D surface engraving, it can do it all. This machine is an essential for everyone who eager to take their Sign making to greater achievements. All our products are of industrial quality and best for business heavy use, so you do not need to worry about its quality, reliability and efficiency. For more details, please visit our web page: http://am.co.za/router/advertising # Or call at 0739967892 The transmission system is made by wear resistant rack and gear with helix teeth. The CNC Signage Business Routing Machine work on 220V household electricity and has the biggest working area, fastest speed and strongest torque in its class. It comes with a T-Slot clamping table which makes 3D engraving easy and electricity-saving. It comes with a 1.8 degree High Torque Stepper Motor that has torque of 3.5 N-m. Stepper motor is installed on the rack and pinion, two on each side of the rack for Y-axis and one on the ball-screw for Z-axes. The spindle of the CNC Signage Business Router is 5kW brushless and water-cooled. It is fitted with a one push oiling system which makes it very easy for the owner to lubricate all the components of the CNC Sign making Router with just one push of the pump once awhile. It has a maximum speed of 12 meter/minute for X/Y axis, and 5 meter/minute for Z axis. To get more info about these products please visit our web page: http://am.co.za/router/advertising # and browse through all its features and specs. If you have any question please leave us a message or CALL on 0739967892 to answer your questions. We guarantee that our products will prove indispensable for your work and it is well worth every cent spent. Advanced Machinery is making machines at "made in China" prices locally here by working with machinery manufactures and setting up assemble-lines in Johannesburg. At last, you still get the very cheap price of equipments made in China and great service and the after-sale support you deserve. Please visit our website: http://am.co.za/ # for CNC Routers, Vinyl Cutting Machines, CNC Laser Cutter, Plasma Cutter and many more.
R 220.999
See product
![1300x2500mm 4.5kw cnc wood routers for sale, 220v electricity, t slot clamp table 1300x2500mm 4.5kw cnc wood routers for sale, 220v electricity, t slot clamp table](/static/img/caticons/servicios.png)
Westonaria (Gauteng)
EasyRoute 1300×2500 4.5kW CNC Precision Engraver Router, 380V, Water Cooled Spindle, Clamping Table (NEW) SKU:R-1325SK/45L → R264999 0745330765 http://am.co.za/router/advertising # All our CNC Sign-making Routing Machine come with a comprehensive technical support, warranty and maintenance plan. We provide our customers with a absolutely free maintenance service every 3 months for the first year. So, if you run into any technical issue, our support team are always here to help you out. Contact 0745330765 NOW or Please visit product page: http://am.co.za/router/advertising # Before buy any other products, do not regret later for NOT choose our products. The work scene in the Signage has changed a lot with the emerge of CNC Signage Business Routing Machine. Nowadays, there is need of fast speed, efficient and multifunction CNC Advertising Routering Machine. The latest CNC Router from Advanced Machinery is the EasyRoute 3 Axes CNC Sign making Routing Machine that provides much much more than that. Whether you need to cut on different types of boards like ABS plastic, Perspex glass, Komotex form plate, and many more, or are looking to engrave Supawood or are looking to perform 3D surface engraving, it can do those all. This equipment is an essential for everyone who want to take their Advertising Industrial to greater heights. If you require to know more detail regarding the functionality of the machinery, you can go through to: http://am.co.za/router/advertising # For more extensive assistance, you can also contact on 0745330765 who are committed to offering resources to our valued customers round the clock. We strive to offer the most excellent available product. Advanced Machinery is focussed on CNC Machines, full automatic and semi-automatic machinery with high precision and high output capacity. All our commercial machinery is for heavy use, minimized downtime is ensured by quality-build products, over stocked parts and always available technicians. With the machine spare parts from four corners of the earth, for example: machine structure of China, Servo-Motors of Japan, CNC Module of Taiwan, High Speed spindles of Italy, precision Switches of German and Power System of America, Advanced Machinery is capable of create world-class machinery for the African continent. Please visit our company website http://am.co.za/ # for Laser Cutting & Engraving machines, CNC Paper Cutter, CNC Routers and CNC Plasma Cutter and many more.
R 265.000
See product