Data centre technician
Top sales list data centre technician
![Data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wbdaaicagicaqicagidagidawyeawmdawcfbqqgcacjcaghc Data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wbdaaicagicaqicagidagidawyeawmdawcfbqqgcacjcaghc](/static/img/caticons/servicios.png)
Dannhauser (KwaZulu Natal)
EasyRoute 2000×3000 3kW CNC Sign-Making Router, 220V, Water Cooled Spindle, Clamping Table (NEW) SKU:R-2030C/30 → R154999 0724055174 http://am.co.za/router/advertising # Quality Significance of CNC Advertising Router The ultimate quality which brings the importance is the spindle. The Spindle disposes half of the electricity used by the router. The greatest amount of power that one can get from a 220V circuit breaker with a reasonable current is 3 kW at the same time standard tooling bits needs 24000 RPM. If you have queries about our products then, we recommend you to have a look at our website: http://am.co.za/router/advertising # where you will find all the highlights and details of our products. Please contact on 0724055174 Technical Support If you experience any problems, our expert technician support is available for your convenience. We also have a forum where our clients can post videos, explain or query any difficulties they may experienced or simply share tips and ideas. 3 Axes CNC Router Elements & Performance This is the main component where the routing machine performs. It is the core and essential component with leading 3 Axis X, Y & Z. It has driving motor with 1.8 degree stepper motor, including maximum speed, pulse equivalent, resolution and working envelope. Go to product page to get all details http://am.co.za/router/advertising # Or make contact with on 0724055174 when you have any questions on our product or its accessories. The top range improved machine comes with t-slot clamps table with holding capacity of any plate with greatest quality by cutting ABS, Perspex Glass, Komotex and 3D engraving on Supawood and all kinds of wood. Such quality is designed for high speed routering machines in the signage industry. It is highly powerful for large performance production worked in large format, as it requires 220V electricity . This ideal machine has carving facility for those customers who complete their tasks with more tools. The NC Signmaking Routering Machine can be worked quickly and efficiently as much time is saved due to the faster work of the machinery tools. When you have any queries regarding this product, please visit the information page: http://am.co.za/router/advertising # and feel free to Call on 0724055174. I will answer your queries and assist you make the right decision. Advanced Machinery is focussed on CNC Machines, automatic & semi automatic machines with high precision and high capacity. All our industry machines are for heavy use, minimized downtime is ensured by quality build products, overstocked parts and always available technicians. With the machine building parts from all over the world, for example: machine main-body of China, servo motors of Japan, CNC Module of Taiwan, High Speed Routing Spindle of Italy, Precision switch of German and Power Supply System of America, Advanced Machinery is capable of create world-class machinery for the African continent. Please open our company website http://am.co.za/ # for Laser Engraver, Vinyl Cutting Machine, CNC Router and Hypertherm Plasma and more.
R 155
See product
![Cable technician - temporary Cable technician - temporary](https://img.clasf.co.za/2020/04/01/Cable-Technician-Temporary-20200401165620.8909890015.jpg)
Port Elizabeth (Eastern Cape)
Job Position: Cable Technician - Temporary Ref: 3457 Location: Port Elizabeth Salary: R7000 to R9000 per month commensurate with experience and qualification Temporary contract – 3 to 6 months Qualifications / Requirements: Experience required: • Valid drivers license essential – required to travel • Must be qualified in: - CAT 5 - CAT 6 • Experience in fibre optic cabling essential • Must be physically fit as work is physically demanding – working at heights etc • Cable installations: - Data cable (Cat5, Cat6) - Telephone cable - Fibre optic cable - Electrical • Installation of: - Network racks - Switches - Routers - Fibre optic equipment - Various rack equipment - UPS installations • Testing and repairing of: - Fibre optic cables - Data cables • Extensive travel throughout the Eastern Cape, overseeing and carrying out sight installations • Site visits to establish job / project requirements • Prospecting and developing of new business • Ordering and purchasing of all stock required for project and contract work • Making out job cards where work is to be carried out • Site visits with clients where applicable to establish locations and aeras where work is to be carried out • Site inspections to ensure client satisfaction with work carried out and signing off on the job card Responsibility: Qualifications / Requirements: Experience required: • Valid drivers license essential – required to travel • Must be qualified in: - CAT 5 - CAT 6 • Experience in fibre optic cabling essential • Must be physically fit as work is physically demanding – working at heights etc • Cable installations: - Data cable (Cat5, Cat6) - Telephone cable - Fibre optic cable - Electrical • Installation of: - Network racks - Switches - Routers - Fibre optic equipment - Various rack equipment - UPS installations • Testing and repairing of: - Fibre optic cables - Data cables • Extensive travel throughout the Eastern Cape, overseeing and carrying out sight installations • Site visits to establish job / project requirements • Prospecting and developing of new business • Ordering and purchasing of all stock required for project and contract work • Making out job cards where work is to be carried out • Site visits with clients where applicable to establish locations and aeras where work is to be carried out • Site inspections to ensure client satisfaction with work carried out and signing off on the job card Salary: R7000 to 9000 Job Reference #: Cable Technician - Temporary
See product
![It senior technician It senior technician](https://img.clasf.co.za/2021/06/29/IT-Senior-Technician-20210629081602.7961820015.jpg)
Cape Town (Western Cape)
IT Senior Technician Mango5 is one of the top BPO Outsource centres in South Africa, offering outsourced services to local and international clients. Our Contact Centre has a rich history of delivering best in class BPO services. We are seeking a skilled IT Senior Technician to join our dynamic team. We comply with the workplace issued COVID regulations and adhere to the health and safety protocols at our premises. Duties and responsibilities include, but are not limited to: • Install software required for all employees in order to perform their duties. • Troubleshoot PC, network and email problems. • Set up new workstations. • User admin on SQL. • Software is installed when agreed on. • Keep servers running. • Reduce IT maintenance cost. • User/Hardware movement. • Quick response and completion times of tickets logged. • Adding PCs/Laptops to the domain. • Installing local and 3rd party software for agent, QA and back office users that is needed for them to work efficiently. • Ensure that PCs and laptops are virus free and password protected before allocation. Skills and requirements: • Excellent interpersonal and client facing skills and a friendly, approachable demeanour. • Excellent written and oral communication skills. • Excellent attention to detail and planning skills. • Ability to analyse problems, identify alternative solutions, and implement recommendations. • CCNA and MCSA or equivalent Network Integration Specialist Diploma. • Advanced knowledge and Experience of the following Networking concepts: TCP/IP, VoIP, QoS, MPLS, Firewall and VPN. • Advanced knowledge and Experience in Server Management VMware and Hyper-V, windows 2012+ and Linux. • Web Technologies knowledge would be an advantage. • Understanding of Helpdesk Processes. • Ability to troubleshoot effectively and quickly. • Own Transport. Working hours: Shift hours: 15:00 - 24:00 or 16:00 to 01:00 (according to day light savings) Must be willing to provide support over weekends. Remuneration Market Related E-Learning portal access to courses Please note that due to the high volume of CV's received; only shortlisted applicants will be contacted. Should you not receive communication from our office within two weeks of submission, kindly consider your application unsuccessful for this position. We will keep your CV on file and re-establish contact with you should opportunities in line with your expertise become available again. Job Reference #: 201080
See product
![It helpdesk technician It helpdesk technician](https://img.clasf.co.za/2022/05/06/IT-Helpdesk-Technician-20220506084940.5231310015.jpg)
Port Elizabeth (Eastern Cape)
IT Helpdesk Technician We are looking for an IT Helpdesk Support Technician for a National Company in Port Elizabeth. Requirements: Must have at least 2 years IT Helpdesk / IT Call Centre experience IT Qualification / Certification is essential Matric qualification is essential Responsibility: Duties: Provide 1st level technical telephonic support to clients Helpdesk call logging for incoming calls Remote online support Be responsible for hardware and software troubleshooting via remote desktop support tools Perform 1st line support in the network and server environments Perform service desk administration tasks on a daily basis Must have excellent telephonic and customer service skills Salary: R10 000 – R11 000 per month Send CV to info@performitpersonnel.co.za Salary: R11000 Job Reference #: ITHDCC001 Consultant Name: Damian Sin Hidge
See product
![Cctv / data technician Cctv / data technician](/static/img/caticons/servicios.png)
Port Elizabeth (Eastern Cape)
Our company is urgently seeking for a CCTC technician / data technician. Must have a valid driver's license and experience in CCTV / Data. Must speak English and Afrikaans and must be able to start immediately. Please forward cv to admin@smartviewpe.co.za
See product
![It helpdesk / it call centre It helpdesk / it call centre](https://img.clasf.co.za/2021/09/17/IT-Helpdesk-IT-Call-Centre-20210917020752.1388930015.jpg)
Port Elizabeth (Eastern Cape)
IT Helpdesk / Call Centre We are looking for an IT Helpdesk Support Technician for a National Company in Port Elizabeth. Requirements: Must have at least 2 years IT Helpdesk / IT Call Centre experience IT Qualification / Certification is essential Matric qualification is essential Responsibility: Duties: Provide 1st level technical telephonic support to clients Helpdesk call logging for incoming calls Remote online support Be responsible for hardware and software troubleshooting via remote desktop support tools Perform 1st line support in the network and server environments Perform service desk administration tasks on a daily basis Must have excellent telephonic and customer service skills Salary: R10 000 – R11 000 per month Send CV to info@performitpersonnel.co.za Salary: R11000 Job Reference #: HELP001 Consultant Name: Damian Sin Hidge
See product
![Cctv and data technician Cctv and data technician](/static/img/caticons/servicios.png)
Port Elizabeth (Eastern Cape)
We are looking for a CCTV technician to join us. Must know how to install a CCTV system and Data points. Fiber will be an advantage. Must have experience as a Junior or Senior technician. Please send CV to: shaun@smartviewpe.co.za
See product
![Vodacom data specialist (phone technician) Vodacom data specialist (phone technician)](https://img.clasf.co.za/2021/07/07/Vodacom-Data-Specialist-Phone-technician-20210707041334.8179620015.jpg)
Port Elizabeth (Eastern Cape)
If you meet the below criteria for position advertised as Vodacom Data Specialist (Cellphone technician), kindly email your CV through to; giorgia.botes@vodadealers.co.za. Vacant post for PE- Vodacom Shop Baywest (Next to Game) Please subject your email as "Data Specialist-Baywest" -Minimum 1-3 years sales/Tech experience -Ability to listen and follow instruction -Tech savvy -Hungry/Sales driven -Motivated -Customer obsessed -Confident to sell & Upsell -Great communication skills -Competitive -Able to multitask -Honest -Able to adapt to change -Able to take initiative -Enjoys working with people Other responsibilities; -Trouble shooting on smartphones/laptops/routers etc. -Able to use a computer (Basic Microsoft) -Transferring data information between devices (Between laptops, smartphones) -Setting up new devices -Software updates on phones/Laptops -No hardware repairs Please keep in mind that this position is a retail position which will require you to work retails hours, this will include weekend work.
See product
![Trainee automotive technician Trainee automotive technician](/static/img/caticons/servicios.png)
Port Elizabeth (Eastern Cape)
Automotive Fitment Centre Trainee automotive technician Must have excellent technical capability Must have a valid code 08 drivers license Be able to work under pressure Please send a two page CV to jobs@eastcape.co.za
See product
![It helpdesk technician It helpdesk technician](https://img.clasf.co.za/2021/10/26/IT-Helpdesk-Technician-20211026071525.2565190015.jpg)
Port Elizabeth (Eastern Cape)
We are looking for an IT Helpdesk Technician for a National Company in Port Elizabeth. Requirements: Must have at least 2 years IT Helpdesk / IT Call Centre experience IT Qualification / Certification is essential Matric qualification is essential Responsibility: Duties: Provide 1st level technical telephonic support to clients Helpdesk call logging for incoming calls Remote online support Be responsible for hardware and software troubleshooting via remote desktop support tools Perform 1st line support in the network and server environments Perform service desk administration tasks on a daily basis Must have excellent telephonic and customer service skills Salary: R10 000 – R11 000 per month Send CV to info@performitpersonnel.co.za Salary: R11000 Job Reference #: ITCC001 Consultant Name: Damian Sin Hidge
See product
![Lynnwood conference centre - pretoria Lynnwood conference centre - pretoria](https://img.clasf.co.za/2024/08/27/Lynnwood-Conference-Centre-Pretoria-20240827195706.6602630015.jpg)
Pretoria (Gauteng)
Lynnwood Conference Centre is a Conference and Events Centre, which is sure to impress and inspire. Ideally situated in Lynnwood, our conference venues vary in size to accommodate small to medium events for any group. We have three small to medium conference rooms that can accommodate 5 to 70 delegates. What to Expect: • Secure conference, workshop, meeting and special celebration facility • Affordable Packages • Tranquil environment and elegant surroundings • Situated close to main routes in the east of Pretoria • Ample safe parking • Generator ensures uninterrupted conferencing and functions amidst power failures • Beautiful outside entertainment area • Three venues and different packages available to suit all your needs • Wheelchair access to the main entrance • Indigenous garden and patio area providing a conference experience with a difference • Air-conditioned conference rooms • Scrumptious, mouth-watering catering The Centre is ideal for groups involved in strategic planning, boardroom table brainstorming, or training…hence the Centre’s logo symbolizes a drop on the surface of water with a ripple effect that spreads and grows ideas in a round table environment. Our packages include: • Venue hire • Data projector • Sweets/Mints • Mineral water • Notepad and pen • Flipchart & markers • Screen, magnetic whiteboard and flexi-rails • WiFi • Parking At Lynnwood Conference Centre, we concentrate on creating customer connections and building lasting working relationships. Contact us today for more information. Gemma Wright Venue Manager
See product
![Security technician wanted Security technician wanted](/static/img/caticons/servicios.png)
Umtata (Eastern Cape)
Our Security Services Company based in Mthatha, the Eastern Cape is looking for a Security Technician to join our team. The Technician will ensure all work as assigned is done to standard and client’s satisfaction. Duties; Installation, maintenance and operation of Alarms, CCTV and Access Control systems. Ensure that work assigned are done timeously, correctly, and billed correctly. Keep track of new products and developments. Performing General Physical Activities – Such as climbing, lifting, balancing, walking, stooping, and handling of materials and equipment. Compilation of Tenders. Training clients on how to handle, operate and care for installed equipment. Ordering and maintenance of stock. Skills: Basic understanding of computers required. Literacy and Numeracy - must have passed English and Maths at Grade 12 level. Valid Drivers License Min 3 years alarm experience in Alarms, CCTV and Data networking and access control. Strong admin skills and ability to work under pressure towards strict deadlines. Willing to travel and work out of normal working hours. Please email CV to admin@tyekssecurity.co.za / m.bahera@tyekssecurity.co.za
See product
![Vacancy: audi technician Vacancy: audi technician](/static/img/caticons/servicios.png)
Port Elizabeth (Eastern Cape)
The Tavcor Motor Group has a vacancy for a qualified mechanic at its Audi Centre workshop in Port Elizabeth. The ideal candidate will have a stable track record in a franchise dealer environment. The remuneration package includes a basic salary, monthly and quarterly incentives, medical aid and provident fund contributions. A lease vehicle benefit is discretionary based on performance. In order to apply you may submit your CV to michael.he@tavcor.co.za
See product
![Wind turbine technician Wind turbine technician](https://img.clasf.co.za/2020/07/17/Wind-Turbine-Technician-20200717224219.8249970015.jpg)
Cape Town (Western Cape)
Wind Turbine Technician An exciting opportunity in the field of Renewable Energy. A leading Facility Management company is looking to recruit Wind Turbine Technicians for a project in the Eastern Cape. Minimum Requirements: · Electrical or Mechanical Qualification · Experience on Wind Turbines · Must have good problem-solving skills and attention to detail · Physically fit and comfortable working at heights and in confined spaces. Competent in MS Office Job Description: · Routine Inspection and Maintenance on Wind Turbines and Transformers · Manage third party service providers · Capture and Analyse Data. Compile Site Reports Please send your CV and salary expectations to 3energyrenewables.sa@gmail.com
See product
![Network cabling technician Network cabling technician](/static/img/caticons/servicios.png)
Middelburg (Mpumalanga)
We are looking to hire Network Cabling Technician with min 5 years experience in data cabling (LAN Infrastructure) to be based in Mpumalanga Province. Min. Requirements: Matric, Driver's license, Krone/Molex Certification & Optic Fibre Certification. Closing date: 31 July 2020.
See product
-
Next →